Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
Peptide: CCNELNR
Peptide within the protein Ara-h-7:
MMVKLSILVALLGALLVVASATRWDPDRGSRGSRWDAPSRGDDQCQRQLQRANLRPCEEHMRRRVEQEQEQEQDEYPYSRRGSRGRQPGESDENQEQRCCNELNRFQNNQRCMCQALQQILQNQSFWVPAGQEPVASDGEGAQELAPELRVQVTKPLRPL
MVKLSILVALLGALLVVASATRWDPDRGSRGSRWDAPSRGDDQCQRQLQRANLRPCEEHIRQRVEKEQEQEQDEYPYIQRGSRGQRPGESDEDQEQRCCNELNRFQNNQRCMCQALQQILQNQSFRFQQDRSQLHQMERELRNLPQNCGFRSPSRCDLSSRTPY
References reporting this peptide:
- Beverly, et al. Assessment of Peanut Allergen Cross-Contact Risk from Reused Roasting Oil Using a Targeted Proteomics Method. Journal of Agricultural and Food Chemistry. 2026
Species Uniqueness
Species containing the peptide CCNELNR are presented below. Accessions and taxid values link to further information hosted on NCBI.
| Species name | Common name | Accession(s) | Tax ID |
|---|---|---|---|
| Arachis hypogaea | Peanut | AAU21496 AAD56719 ABW17159 AAU21496 AAD56719 ABW17159 |
3818 |
| Arachis ipaensis | Arachis ipaensis | XP_016171959 XP_016171959 |
130454 |
| Zostera marina | Zostera marina | KMZ69740 KMZ69740 |
29655 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.