Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
Peptide: GDAKPDEEELK
Peptide within the protein Ara-h-8:
MGVFTFEDEITSTVPPAKLYNAMKDADSITPKIIDDVKSVEIVEGNGGPGTIKKLTIVEDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKITFETKLVEGPNGGSIGKLTLKYHTKGDAKPDEEELKKGKAKGEGLFRAIEGYVLANPTQY
MGVHTFEEESTSPVPPAKLFKATVVDGDELTPKLIPAIQSIEIVEGNGGPGTVKKVTAVEDGKTSYVLHKIDAIDEATYTYDYTISGGTGFQEILEKVSFKTKLEAADGGSKIKVSVTFHTKGDAPLPDEVHQDVKQKSQGIFKAIEGYVLSN
References reporting this peptide:
None.
Species Uniqueness
Species containing the peptide GDAKPDEEELK are presented below. Accessions and taxid values link to further information hosted on NCBI.
| Species name | Common name | Accession(s) | Tax ID |
|---|---|---|---|
| Arachis duranensis | Peanut ancestor | XP_015937483 XP_015937471 XP_015937459 |
130453 |
| Arachis hypogaea | Peanut | 4M9B_A ACD39391 |
3818 |
| Arachis ipaensis | Arachis ipaensis | XP_016197791 |
130454 |
| Cajanus cajan | Pigeon pea | KYP57924 |
3821 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.