If you found this site useful, please cite:
Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
Peptide: ELINLATMCR
Peptide within the protein Gly-m-8:
MTKFTILLISLLFCIAHTCSASKWQHQQDSCRKQLQGVNLTPCEKHIMEKIQGRGDDDDDDDDDNHILRTMRGRINYIRRNEGKDEDEEEEGHMQKCCTEMSELRSPKCQCKALQKIMENQSEELEEKQKKKMEKELINLATMCRFGPMIQCDLSSDD
References reporting this peptide:
- Leitner A., et al. Identification of Marker Proteins for the Adulteration of Meat Products with Soybean Proteins by Multidimensional Liquid Chromatography−Tandem Mass Spectrometry†. Journal of Proteome Research. 2006
- Planque M., et al. Advances in ultra-high performance liquid chromatography coupled to tandem mass spectrometry for sensitive detection of several food allergens in complex and processed foodstuffs. Journal of Chromatography A. 2016
- Planque, et al. Development of a strategy for the quantification of food allergens in several food products by mass spectrometry in a routine laboratory. Food Chemistry. 2019
- Planque, et al. Liquid chromatography coupled to tandem mass spectrometry for detecting ten allergens in complex and incurred foodstuffs. Journal of Chromatography A. 2017
Species Uniqueness
Species containing the peptide ELINLATMCR are presented below. Accessions and taxid values link to further information hosted on NCBI.
| Species name | Common name | Accession(s) | Tax ID |
|---|---|---|---|
| Glycine max | Soybean | NP_001238443 NP_001234950 |
3847 |
| Glycine soja | Glycine soja | KHN36721 |
3848 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.